PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G49130.2
Common NameBBX17, COL8, F27J15.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CO-like
Protein Properties Length: 319aa    MW: 37500.8 Da    PI: 5.9391
Description B-box type zinc finger protein with CCT domain
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G49130.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.98.3e-081759238
     zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                 ++r C+++ +k++ ++C +++ +lC+ C ++ H+       H+
  AT1G49130.2 17 QPRACELCLNKHAVWYCASDDAFLCHVCDESVHSAnhvatkHE 59
                 7899*****************************6575556665 PP

2CCT67.43.8e-23271314144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++ RY++Krk+R+FeKkirYe+RK++A++RpR+KGrFv+++
  AT1G49130.2 271 REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS 314
                  9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.0961663IPR000315B-box-type zinc finger
SMARTSM003364.6E-91663IPR000315B-box-type zinc finger
PfamPF006431.8E-61760IPR000315B-box-type zinc finger
CDDcd000211.54E-91963No hitNo description
PfamPF062039.8E-18271313IPR010402CCT domain
PROSITE profilePS5101715.944271313IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MFCAEIMISK YQEDVKQPRA CELCLNKHAV WYCASDDAFL CHVCDESVHS ANHVATKHER  60
VCLRTNEISN DVRGGTTLTS VWHSGFRRKA RTPRSRYEKK PQQKIDDERR REDPRVPEIG  120
GEVMFFIPEA NDDDMTSLVP EFEGFTEMGF FLSNHNGTEE TTKQFNFEEE ADTMEDLYYN  180
GEEEDKTDGA EACPGQYLMS CKKDYDNVIT VSEKTEEIED CYENNARHRL NYENVIAAWD  240
KQESPRDVKN NTSSFQLVPP GIEEKRVRSE REARVWRYRD KRKNRLFEKK IRYEVRKVNA  300
DKRPRMKGRF VRRSLAIDS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT1G49130
AtGenExpressAT1G49130
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G49130.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G49130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3173810.0AK317381.1 Arabidopsis thaliana AT1G49130 mRNA, complete cds, clone: RAFL25-23-K13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031160.10.0zinc finger protein CONSTANS-LIKE 8
SwissprotQ9M9B30.0COL8_ARATH; Zinc finger protein CONSTANS-LIKE 8
TrEMBLF4I1N00.0F4I1N0_ARATH; Zinc finger protein CONSTANS-LIKE 8
STRINGAT1G49130.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Robson F, et al.
    Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants.
    Plant J., 2001. 28(6): p. 619-31
    [PMID:11851908]
  3. Griffiths S,Dunford RP,Coupland G,Laurie DA
    The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis.
    Plant Physiol., 2003. 131(4): p. 1855-67
    [PMID:12692345]
  4. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  5. Khanna R, et al.
    The Arabidopsis B-box zinc finger family.
    Plant Cell, 2009. 21(11): p. 3416-20
    [PMID:19920209]